(data stored in ACNUC30630 zone)

EMBL: AP009044.PE724

AP009044.PE724       Location/Qualifiers
FT   CDS             739490..739858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53651"
FT                   /db_xref="GOA:A4QBQ4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ4"
FT                   /protein_id="BAF53651.1"
FT                   /translation="MARLAGVDLPRNKRMEVALTYIYGIGPARSKQLLEETGISPDLRT
FT                   DNLTDEQIAALRDVIEGTWKVEGDLRRQVQADIRRKIEIGCYQGIRHRRGLPVRGQRTK
FT                   TNARTRKGPKKTIAGKKK"
     MARLAGVDLP RNKRMEVALT YIYGIGPARS KQLLEETGIS PDLRTDNLTD EQIAALRDVI        60
     EGTWKVEGDL RRQVQADIRR KIEIGCYQGI RHRRGLPVRG QRTKTNARTR KGPKKTIAGK       120
     KK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page