(data stored in ACNUC30630 zone)

EMBL: AP009044.PE735

AP009044.PE735       Location/Qualifiers
FT   CDS             750005..751312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53662"
FT                   /db_xref="GOA:A4QBR5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR5"
FT                   /protein_id="BAF53662.1"
FT                   /translation="MSNAVAQDLMTIADIVEATTTAPIPFHITAFDGSFTGPEDAPYQL
FT                   FVANTDAVSYIATAPGDLGLARAYLMGDLIVEGEHPGHPYGIFDALKEFYRCFKRPDAS
FT                   TTLQIMWTLRKMNALKFQEIPPMEQAPAWRKALINGLASRHSKSRDKKAISYHYDVGNE
FT                   FYSLFLDDSMTYTCAYYPTPESSLEEAQENKYRLIFEKLRLKEGDRLLDVGCGWGGMVR
FT                   YAAKHGVKAIGVTLSEQQYEWGQAEIKRQGLENLAEIRFMDYRDVPETGFDAISAIGII
FT                   EHIGVNNYPDYFELLSSKLKTGGLMLNHSITYPDNRPRHAGAFIDRYIFPDGELTGSGT
FT                   LIKHMQDNGFEVLHEENLRFDYQRTLHAWSENLKENWEEAVELAGEPTARLFGLYMAGS
FT                   EWGFAHNIVQLHQVLGVKLDEQGSRGEVPERMWWTI"
     MSNAVAQDLM TIADIVEATT TAPIPFHITA FDGSFTGPED APYQLFVANT DAVSYIATAP        60
     GDLGLARAYL MGDLIVEGEH PGHPYGIFDA LKEFYRCFKR PDASTTLQIM WTLRKMNALK       120
     FQEIPPMEQA PAWRKALING LASRHSKSRD KKAISYHYDV GNEFYSLFLD DSMTYTCAYY       180
     PTPESSLEEA QENKYRLIFE KLRLKEGDRL LDVGCGWGGM VRYAAKHGVK AIGVTLSEQQ       240
     YEWGQAEIKR QGLENLAEIR FMDYRDVPET GFDAISAIGI IEHIGVNNYP DYFELLSSKL       300
     KTGGLMLNHS ITYPDNRPRH AGAFIDRYIF PDGELTGSGT LIKHMQDNGF EVLHEENLRF       360
     DYQRTLHAWS ENLKENWEEA VELAGEPTAR LFGLYMAGSE WGFAHNIVQL HQVLGVKLDE       420
     QGSRGEVPER MWWTI                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page