(data stored in ACNUC30630 zone)

EMBL: AP009044.PE736

AP009044.PE736       Location/Qualifiers
FT   CDS             751513..751941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53663"
FT                   /db_xref="GOA:A4QBR6"
FT                   /db_xref="InterPro:IPR013434"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR6"
FT                   /protein_id="BAF53663.1"
FT                   /translation="MGTMREMVSDRIDRLQEAHARSKQKKFGFLVRPGTLILGWLVTII
FT                   GLITIPLPGQGWLTTFIGVGILSLELKWAKNLLAWGVHQYDRFFTWYGKKSFRFRMAML
FT                   ALMILLIWVVFIVTFWLMWHAGTIPWADEFFTWLGLSR"
     MGTMREMVSD RIDRLQEAHA RSKQKKFGFL VRPGTLILGW LVTIIGLITI PLPGQGWLTT        60
     FIGVGILSLE LKWAKNLLAW GVHQYDRFFT WYGKKSFRFR MAMLALMILL IWVVFIVTFW       120
     LMWHAGTIPW ADEFFTWLGL SR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page