(data stored in ACNUC30630 zone)

EMBL: AP009044.PE74

AP009044.PE74        Location/Qualifiers
FT   CDS             82281..82622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6004"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21066"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR83"
FT                   /protein_id="BAQ21066.1"
FT                   /translation="MEESEDSPLNRFTPEDGDRNAIFDIKAIYQQHYHSFDLFDAPEVF
FT                   FPRVGPYKLQNLENVWTALDSQDIFESRGISRDGAIVVVRPDQYVAAVLPLEDTAGLAE
FT                   FFNGNLLEP"
     MEESEDSPLN RFTPEDGDRN AIFDIKAIYQ QHYHSFDLFD APEVFFPRVG PYKLQNLENV        60
     WTALDSQDIF ESRGISRDGA IVVVRPDQYV AAVLPLEDTA GLAEFFNGNL LEP              113
//

If you have problems or comments...

PBIL Back to PBIL home page