(data stored in ACNUC30630 zone)

EMBL: AP009044.PE741

AP009044.PE741       Location/Qualifiers
FT   CDS             759795..760121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53668"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS1"
FT                   /protein_id="BAF53668.1"
FT                   /translation="MSNLFRTESDVMLATAGQVDDINDQVQSELSRLRGVVDSVRGSWA
FT                   GQAQVSFDSLMNRWNSSARQLQEALASISDNIRHNARSFENTEADNSQAFNAVGAGDGA
FT                   GLPL"
     MSNLFRTESD VMLATAGQVD DINDQVQSEL SRLRGVVDSV RGSWAGQAQV SFDSLMNRWN        60
     SSARQLQEAL ASISDNIRHN ARSFENTEAD NSQAFNAVGA GDGAGLPL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page