(data stored in ACNUC30630 zone)

EMBL: AP009044.PE746

AP009044.PE746       Location/Qualifiers
FT   CDS             763762..764067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53673"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS6"
FT                   /protein_id="BAF53673.1"
FT                   /translation="MSGFELKIGESLATLRGLLGETAQQHSIHRQRVPYYSPSASGRGF
FT                   SAHGVALADMFEGLHRGVEKRIDAFTQTTQAAEEEVKRFDNTDKVFGAGCDGIDPK"
     MSGFELKIGE SLATLRGLLG ETAQQHSIHR QRVPYYSPSA SGRGFSAHGV ALADMFEGLH        60
     RGVEKRIDAF TQTTQAAEEE VKRFDNTDKV FGAGCDGIDP K                           101
//

If you have problems or comments...

PBIL Back to PBIL home page