(data stored in ACNUC30630 zone)

EMBL: AP009044.PE75

AP009044.PE75        Location/Qualifiers
FT   CDS             82789..84159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53032"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y9"
FT                   /protein_id="BAF53032.1"
FT                   /translation="MLIERIYDEDLAQASYFIGCQAHNTAVVVDPRRDIAIYLDMAKKN
FT                   GMEIVGVTETHIHADYLSGTRELAAATNATMYVSGEGGADWQYEFDAERLYDGGEIRLG
FT                   NLVLTAVHTPGHTPEHLSFLLKDGAFADEPGFMLTGDFVFAGDLGRPDLLDQAAGGVDT
FT                   RFEGARQMFKSLKEKFLTLPDHIQIFPGHGSGSACGKALGSVPSTTLGYERQFAWWGKY
FT                   LEADDEQGFIDELLEGQPDAPAYFGRMKRQNRQGPAIMGAREPLPQLEASDLHDVIVVD
FT                   TRSADEVHQGTVAGAVNIPAGNSMAKFGSWTVDPEKDSRALVLLAASQIGAMEMWDHLV
FT                   RVGIDNVAGFVTNFDGVDLVAPQTVSPDELDKFEYDLLLDVRNRSEVEEGYIPGALHIN
FT                   GASVLWNLEKLPRDGKIVSYCKSGTRSSIAASTLRNAGFDVVELEGSYDNWVRHNAQ"
     MLIERIYDED LAQASYFIGC QAHNTAVVVD PRRDIAIYLD MAKKNGMEIV GVTETHIHAD        60
     YLSGTRELAA ATNATMYVSG EGGADWQYEF DAERLYDGGE IRLGNLVLTA VHTPGHTPEH       120
     LSFLLKDGAF ADEPGFMLTG DFVFAGDLGR PDLLDQAAGG VDTRFEGARQ MFKSLKEKFL       180
     TLPDHIQIFP GHGSGSACGK ALGSVPSTTL GYERQFAWWG KYLEADDEQG FIDELLEGQP       240
     DAPAYFGRMK RQNRQGPAIM GAREPLPQLE ASDLHDVIVV DTRSADEVHQ GTVAGAVNIP       300
     AGNSMAKFGS WTVDPEKDSR ALVLLAASQI GAMEMWDHLV RVGIDNVAGF VTNFDGVDLV       360
     APQTVSPDEL DKFEYDLLLD VRNRSEVEEG YIPGALHING ASVLWNLEKL PRDGKIVSYC       420
     KSGTRSSIAA STLRNAGFDV VELEGSYDNW VRHNAQ                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page