(data stored in ACNUC30630 zone)

EMBL: AP009044.PE757

AP009044.PE757       Location/Qualifiers
FT   CDS             772810..773844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53683"
FT                   /db_xref="GOA:A4QBT6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBT6"
FT                   /protein_id="BAF53683.1"
FT                   /translation="MIVLGIESSCDETGVGVVKLDGEGNLEILADSVASSMQEHARFGG
FT                   VVPEIASRAHLESMVPVMREALRQAGVDKPDAVAATVGPGLAGALLVGASAAKAYAAAW
FT                   GVPFYAVNHLGGHVAVANLEGETLPHAVALLVSGGHTQLLEVDAVGLPMKELGSTLDDA
FT                   AGEAYDKVSRLLGLGYPGGPIIDKLARRGNPEAIAFPRGLMKKSDSRHDFSFSGLKTSV
FT                   ARYVEAAERNGEVISVEDVCASFQEAVCDVLTFKAVRACRDVGAKVLLLGGGVAANSRL
FT                   RELAQERCDKAGIELRVPRFNLCTDNGVMIAALAAQRIHEGAQESPISVGTDPSLSVET
FT                   PQVF"
     MIVLGIESSC DETGVGVVKL DGEGNLEILA DSVASSMQEH ARFGGVVPEI ASRAHLESMV        60
     PVMREALRQA GVDKPDAVAA TVGPGLAGAL LVGASAAKAY AAAWGVPFYA VNHLGGHVAV       120
     ANLEGETLPH AVALLVSGGH TQLLEVDAVG LPMKELGSTL DDAAGEAYDK VSRLLGLGYP       180
     GGPIIDKLAR RGNPEAIAFP RGLMKKSDSR HDFSFSGLKT SVARYVEAAE RNGEVISVED       240
     VCASFQEAVC DVLTFKAVRA CRDVGAKVLL LGGGVAANSR LRELAQERCD KAGIELRVPR       300
     FNLCTDNGVM IAALAAQRIH EGAQESPISV GTDPSLSVET PQVF                        344
//

If you have problems or comments...

PBIL Back to PBIL home page