(data stored in ACNUC30630 zone)

EMBL: AP009044.PE758

AP009044.PE758       Location/Qualifiers
FT   CDS             773863..775587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53684"
FT                   /db_xref="GOA:A4QBT7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT7"
FT                   /protein_id="BAF53684.1"
FT                   /translation="MKPVFSVDQIRRAENTLFELQADPDELMISAASAVADVALAMVDG
FT                   PAPAVSSEESILLLVGPGGNGGDALYAGAFLAEEGHHVDALLLGNGKVHQSALAYYESL
FT                   GGQIISDFPPHYLYRLVIDGLFGIGGRGGLTPELASLVESFSASGIPILAIDVPSGVHA
FT                   DSGELPPGVLVTVEGFDDDAPMARQKIPAHIDADVTITFGGLRRAHAVSPACGEVLCAD
FT                   INIAGGGGKSLSAELSQVQAEDATPQMFASKAYQRKDSLFERANLKATAPHIHRIGQHF
FT                   TLLNMEPGPDHDKYSGGIVGIVAGSGTYPGAAVLSVKAAVRATSAMVRYVGPAVNFVIQ
FT                   SLPEVVATQSLATAGRVQAWVHGPGRGLEAEQSAELAELLSRPEPVLIDADSLSLLQLS
FT                   AELRQALRERKAPTVLTPHKGEFERIAAELRSEGVEIPQADKDPIGAAQALAKEFDCCV
FT                   LLKGKYTVIAAHDFVHAINAGHSWLATPGSGDVLSGLVGAHLAQSYAELNRLPEFFPDV
FT                   TLSDSAIYTQIAPAATIHAVAAGLAARTEFGFAPTSASLIADAIPAATAKVDLKRIV"
     MKPVFSVDQI RRAENTLFEL QADPDELMIS AASAVADVAL AMVDGPAPAV SSEESILLLV        60
     GPGGNGGDAL YAGAFLAEEG HHVDALLLGN GKVHQSALAY YESLGGQIIS DFPPHYLYRL       120
     VIDGLFGIGG RGGLTPELAS LVESFSASGI PILAIDVPSG VHADSGELPP GVLVTVEGFD       180
     DDAPMARQKI PAHIDADVTI TFGGLRRAHA VSPACGEVLC ADINIAGGGG KSLSAELSQV       240
     QAEDATPQMF ASKAYQRKDS LFERANLKAT APHIHRIGQH FTLLNMEPGP DHDKYSGGIV       300
     GIVAGSGTYP GAAVLSVKAA VRATSAMVRY VGPAVNFVIQ SLPEVVATQS LATAGRVQAW       360
     VHGPGRGLEA EQSAELAELL SRPEPVLIDA DSLSLLQLSA ELRQALRERK APTVLTPHKG       420
     EFERIAAELR SEGVEIPQAD KDPIGAAQAL AKEFDCCVLL KGKYTVIAAH DFVHAINAGH       480
     SWLATPGSGD VLSGLVGAHL AQSYAELNRL PEFFPDVTLS DSAIYTQIAP AATIHAVAAG       540
     LAARTEFGFA PTSASLIADA IPAATAKVDL KRIV                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page