(data stored in ACNUC30630 zone)

EMBL: AP009044.PE76

AP009044.PE76        Location/Qualifiers
FT   CDS             complement(84235..84981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53033"
FT                   /db_xref="GOA:A4Q9Z0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z0"
FT                   /protein_id="BAF53033.1"
FT                   /translation="MTATLIITLFLSLFIGISLGLLGGGGSILTVPILTYVAGLEPREA
FT                   IAASLFVVGTTSLVSAISHARNGRVRWKTGLLFGAAGMVGAFGGGLLGGYIPGTILMIA
FT                   FALMMIATSTAMLRGRKEKKGASKSSLWRVLVDGLVVGAVTGLVGAGGGFLVVPALALL
FT                   GGLSMPVAVGTSLVVITMKSFAGLAGYLTSVQLDWGLVLMVTAAAIVGSLAGSRLAGRV
FT                   PETLLRKGFGVFVLVMGVFVLGLELL"
     MTATLIITLF LSLFIGISLG LLGGGGSILT VPILTYVAGL EPREAIAASL FVVGTTSLVS        60
     AISHARNGRV RWKTGLLFGA AGMVGAFGGG LLGGYIPGTI LMIAFALMMI ATSTAMLRGR       120
     KEKKGASKSS LWRVLVDGLV VGAVTGLVGA GGGFLVVPAL ALLGGLSMPV AVGTSLVVIT       180
     MKSFAGLAGY LTSVQLDWGL VLMVTAAAIV GSLAGSRLAG RVPETLLRKG FGVFVLVMGV       240
     FVLGLELL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page