(data stored in ACNUC30630 zone)

EMBL: AP009044.PE763

AP009044.PE763       Location/Qualifiers
FT   CDS             779060..779242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53689"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU2"
FT                   /protein_id="BAF53689.1"
FT                   /translation="MADTERELATLVPQATAGDRRALQRIMEIIHPMFCVMLALVLEVD
FT                   GSQRQKTLLKRSVWQ"
     MADTERELAT LVPQATAGDR RALQRIMEII HPMFCVMLAL VLEVDGSQRQ KTLLKRSVWQ        60
//

If you have problems or comments...

PBIL Back to PBIL home page