(data stored in ACNUC30630 zone)

EMBL: AP009044.PE764

AP009044.PE764       Location/Qualifiers
FT   CDS             779284..779625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53690"
FT                   /db_xref="GOA:A4QBU3"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU3"
FT                   /protein_id="BAF53690.1"
FT                   /translation="MAFVYGIASNKVADAHRAMSRDKSTPIEEVPETSPDTFTPEDFAL
FT                   VSDGSNRVRELLDLLSEKARDILILRVIVGLSAEETAEMVGSTPGAVRVAQHRALTTLR
FT                   STLEQQENK"
     MAFVYGIASN KVADAHRAMS RDKSTPIEEV PETSPDTFTP EDFALVSDGS NRVRELLDLL        60
     SEKARDILIL RVIVGLSAEE TAEMVGSTPG AVRVAQHRAL TTLRSTLEQQ ENK              113
//

If you have problems or comments...

PBIL Back to PBIL home page