(data stored in ACNUC30630 zone)

EMBL: AP009044.PE768

AP009044.PE768       Location/Qualifiers
FT   CDS             782876..784000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53694"
FT                   /db_xref="GOA:A4QBU7"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU7"
FT                   /protein_id="BAF53694.1"
FT                   /translation="MRDHVEIGIGREARRTYSLDDISVVSSRRTRSSKDVDTTWHIDAY
FT                   KFDLPFMNHPSDALASPKFVIEMGKQGGLGVINAEGLWGRHADLDEAIAKVIAAYEEGD
FT                   QAAATRTLQELHSAPLDTELLSERIAQVRDSGEIVAVRVSPQNVREIAPIVIKAGADLL
FT                   VIQGTLISAEHVNTGGEALNLKEFIGSLDVPVIAGGVNDYTTALHMMRTGAVGIIVGGG
FT                   ENTNSLALGMEVSMATAIADVAAARRDYLDETGGRYVHIIADGSIENSGDVVKAIACGA
FT                   DAVVLGSPLARAKEAAGKGYFWPAVAAHPRFPRGVVTESVELDEQAPSLEQILHGPSTM
FT                   PWGVENFEGGLKRALAKCGYTDLKSFQKVSLHVN"
     MRDHVEIGIG REARRTYSLD DISVVSSRRT RSSKDVDTTW HIDAYKFDLP FMNHPSDALA        60
     SPKFVIEMGK QGGLGVINAE GLWGRHADLD EAIAKVIAAY EEGDQAAATR TLQELHSAPL       120
     DTELLSERIA QVRDSGEIVA VRVSPQNVRE IAPIVIKAGA DLLVIQGTLI SAEHVNTGGE       180
     ALNLKEFIGS LDVPVIAGGV NDYTTALHMM RTGAVGIIVG GGENTNSLAL GMEVSMATAI       240
     ADVAAARRDY LDETGGRYVH IIADGSIENS GDVVKAIACG ADAVVLGSPL ARAKEAAGKG       300
     YFWPAVAAHP RFPRGVVTES VELDEQAPSL EQILHGPSTM PWGVENFEGG LKRALAKCGY       360
     TDLKSFQKVS LHVN                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page