(data stored in ACNUC30630 zone)

EMBL: AP009044.PE79

AP009044.PE79        Location/Qualifiers
FT   CDS             86004..86261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53036"
FT                   /db_xref="GOA:A4Q9Z3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z3"
FT                   /protein_id="BAF53036.1"
FT                   /translation="MQLNPDEITPVLNRLKRAQGQLTGVIRMLDEGEDCKAVVTQLSAV
FT                   AKALDRAGFAIIATGLEQCLTNPDGDMDKKELEKLFLSLA"
     MQLNPDEITP VLNRLKRAQG QLTGVIRMLD EGEDCKAVVT QLSAVAKALD RAGFAIIATG        60
     LEQCLTNPDG DMDKKELEKL FLSLA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page