(data stored in ACNUC30630 zone)

EMBL: AP009044.PE83

AP009044.PE83        Location/Qualifiers
FT   CDS             89304..90980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53040"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z7"
FT                   /protein_id="BAF53040.1"
FT                   /translation="MPSFKSARWRMNRRLFLGTSAAIIAVGGVLGGVQVVPYISSGEIQ
FT                   TSASSTATIDVGAGNVDIFDTSVSHEISLQVSQESLDEMLADYQEDGSKTWVKATITID
FT                   GVTIENVGIRLKGNSTLSGLGRTSEEGGPQAPEGVEEFTDLSEEEIAQFEEQFAAQQGT
FT                   TDASETGETAETEETRGPGGGMGGGGMGGMTSVDADDVSTWPLLISFDKYEDGRVYQGM
FT                   TQLALRPGTTVVNEAMALALTAETDQVSQQSSFTTFSLNDEPSTTRLLLEHPDENYADA
FT                   LGNGVLFKADSNSSFTYQGEDQTEYDGQFKQINGDGNGDIQPIINLLKWLDTASDEEFA
FT                   EHLSDYVDVESFARYVATQNLLVNSDDMAGPGSNYYLWYDYDTGLISVISWDLNLAMSG
FT                   STDAGPDDEISMGGGGGMRPGGTTDTEIEGTTTEDMPAMGEMADTENMPDMANMQQGER
FT                   PEGMPDMGEMPDREGGGSMGGNQLKERFLASDAFTEIYEQVYWELYEEMYGSGTAIELL
FT                   DEIAASIPETDAVTADEIATEVASMREWITARTEALAALQE"
     MPSFKSARWR MNRRLFLGTS AAIIAVGGVL GGVQVVPYIS SGEIQTSASS TATIDVGAGN        60
     VDIFDTSVSH EISLQVSQES LDEMLADYQE DGSKTWVKAT ITIDGVTIEN VGIRLKGNST       120
     LSGLGRTSEE GGPQAPEGVE EFTDLSEEEI AQFEEQFAAQ QGTTDASETG ETAETEETRG       180
     PGGGMGGGGM GGMTSVDADD VSTWPLLISF DKYEDGRVYQ GMTQLALRPG TTVVNEAMAL       240
     ALTAETDQVS QQSSFTTFSL NDEPSTTRLL LEHPDENYAD ALGNGVLFKA DSNSSFTYQG       300
     EDQTEYDGQF KQINGDGNGD IQPIINLLKW LDTASDEEFA EHLSDYVDVE SFARYVATQN       360
     LLVNSDDMAG PGSNYYLWYD YDTGLISVIS WDLNLAMSGS TDAGPDDEIS MGGGGGMRPG       420
     GTTDTEIEGT TTEDMPAMGE MADTENMPDM ANMQQGERPE GMPDMGEMPD REGGGSMGGN       480
     QLKERFLASD AFTEIYEQVY WELYEEMYGS GTAIELLDEI AASIPETDAV TADEIATEVA       540
     SMREWITART EALAALQE                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page