(data stored in ACNUC30630 zone)

EMBL: AP009044.PE86

AP009044.PE86        Location/Qualifiers
FT   CDS             92847..94118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53043"
FT                   /db_xref="GOA:A4QA00"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA00"
FT                   /protein_id="BAF53043.1"
FT                   /translation="MSTIPLNRLAVIAAIIGVGTGLFVAALNWSAIGVERLVYGADHLH
FT                   NHNPVANVSPLRLSITVIVLSVVASWAWFFVHRTGSKEVSIVGAIRGEKMPILETIASA
FT                   FLQVTTVAAGAPVGAENAPRIAGALVGERFSRWLQLDIDAKRILVASAAGAGLGASFHL
FT                   PLAGVLFALEVLLVEASTRTVVIAIITTTAAVATTGFFVQTPDVFSTVPLTESPWMLLA
FT                   AMVTGVVAGMCGHWFSAAAHKMAQASPKGVRILWQMPLGFVVIAAVIYFFPETLANPRW
FT                   LADSMLGDGLILSTILLVLVLRTAMFLLAFRVGMVGGNLIPAFALGSMVGGVVGAVLEP
FT                   ITNVPIAAFALLGAAAFLSTTMAAPLFGLIAAVEFTDMEAQGYLPIFLAVASAVLAVRV
FT                   WSVIAKRELRAIPITYASWTGELK"
     MSTIPLNRLA VIAAIIGVGT GLFVAALNWS AIGVERLVYG ADHLHNHNPV ANVSPLRLSI        60
     TVIVLSVVAS WAWFFVHRTG SKEVSIVGAI RGEKMPILET IASAFLQVTT VAAGAPVGAE       120
     NAPRIAGALV GERFSRWLQL DIDAKRILVA SAAGAGLGAS FHLPLAGVLF ALEVLLVEAS       180
     TRTVVIAIIT TTAAVATTGF FVQTPDVFST VPLTESPWML LAAMVTGVVA GMCGHWFSAA       240
     AHKMAQASPK GVRILWQMPL GFVVIAAVIY FFPETLANPR WLADSMLGDG LILSTILLVL       300
     VLRTAMFLLA FRVGMVGGNL IPAFALGSMV GGVVGAVLEP ITNVPIAAFA LLGAAAFLST       360
     TMAAPLFGLI AAVEFTDMEA QGYLPIFLAV ASAVLAVRVW SVIAKRELRA IPITYASWTG       420
     ELK                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page