(data stored in ACNUC30630 zone)

EMBL: AP009044.PE9

AP009044.PE9         Location/Qualifiers
FT   CDS             complement(9471..9914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52970"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S7"
FT                   /protein_id="BAF52970.1"
FT                   /translation="MTSLKDLLVSTNADAAIADMSAFIEETVGKQSGTSGIALKGAMGA
FT                   ATKIDSDIVAKGSRRLLPELADSLDGLWQEYQNGGTAANFGEHLEANSSTALDAILSVA
FT                   DKNAESINVPGLGKVYKGVRGKAAKVIEQELPAIGQLIEKNAQ"
     MTSLKDLLVS TNADAAIADM SAFIEETVGK QSGTSGIALK GAMGAATKID SDIVAKGSRR        60
     LLPELADSLD GLWQEYQNGG TAANFGEHLE ANSSTALDAI LSVADKNAES INVPGLGKVY       120
     KGVRGKAAKV IEQELPAIGQ LIEKNAQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page