(data stored in ACNUC30630 zone)

EMBL: AP009044.PE98

AP009044.PE98        Location/Qualifiers
FT   CDS             104352..104693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53055"
FT                   /db_xref="GOA:A4QA12"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA12"
FT                   /protein_id="BAF53055.1"
FT                   /translation="MLPPRFRRLLLSRASIMRGHLIDGDGRCIHYHGPFDVVGNKCATC
FT                   NEWWACHRCHEEIANHPFGKMLIDAPSSLQCGHCGELMAYGVQKCPRCGHNFNPGCSLH
FT                   TPLYYEMPS"
     MLPPRFRRLL LSRASIMRGH LIDGDGRCIH YHGPFDVVGN KCATCNEWWA CHRCHEEIAN        60
     HPFGKMLIDA PSSLQCGHCG ELMAYGVQKC PRCGHNFNPG CSLHTPLYYE MPS              113
//

If you have problems or comments...

PBIL Back to PBIL home page