(data stored in ACNUC30630 zone)

EMBL: AP009256.AROP

AP009256.AROP        Location/Qualifiers
FT   CDS             complement(115008..116537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="BAD_0084"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="Orthologue of BL0152"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38865"
FT                   /db_xref="GOA:A0ZZI2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI2"
FT                   /protein_id="BAF38865.1"
FT                   /translation="MSDVTAAKKPRGTDDVPVPPTLRKSLKNRHIQLIALGGAIGTGLF
FT                   YGSSESIQLAGPSILLAYLVGGLAIFMIVRALSEMAVEDPKAGAFSYYATRYWSRRAGF
FT                   ISGWNYWFNYVLVAMVELAVVGSFVNYWFPNIPKWVSAAVFLVAIAALNLMGVNKFGEF
FT                   EFWFAIIKIVAVLAMILGGLYVVIANVPTASGIRASFANWFTVDGGFLPHGLMTRNADG
FT                   TWTGLLMALVVVMFSFGGTELIGITAGETENPRTTIPKATNGIIWRILVFYICALGVIM
FT                   AVIPWSKIDGDSSPFVQIFDSVGVHAAAGILNFVCLTAVMSVYNSGLYANSRMLYSLAK
FT                   QGNAPAYLGKLSKKGVPVGGVITSAIIIAIAVVVVFVWPEFAFNYLMSIATIAAAINWI
FT                   MIMITEIKFRRMVAAGDGPAELKGLKGKEALDKIAFKLPFANVTPYVVIAFMLLVVVLM
FT                   CFSASYRIAVIAGVIWLAVLFAAAQLALGKSGSERGEDAAVIVDAAAATAE"
     MSDVTAAKKP RGTDDVPVPP TLRKSLKNRH IQLIALGGAI GTGLFYGSSE SIQLAGPSIL        60
     LAYLVGGLAI FMIVRALSEM AVEDPKAGAF SYYATRYWSR RAGFISGWNY WFNYVLVAMV       120
     ELAVVGSFVN YWFPNIPKWV SAAVFLVAIA ALNLMGVNKF GEFEFWFAII KIVAVLAMIL       180
     GGLYVVIANV PTASGIRASF ANWFTVDGGF LPHGLMTRNA DGTWTGLLMA LVVVMFSFGG       240
     TELIGITAGE TENPRTTIPK ATNGIIWRIL VFYICALGVI MAVIPWSKID GDSSPFVQIF       300
     DSVGVHAAAG ILNFVCLTAV MSVYNSGLYA NSRMLYSLAK QGNAPAYLGK LSKKGVPVGG       360
     VITSAIIIAI AVVVVFVWPE FAFNYLMSIA TIAAAINWIM IMITEIKFRR MVAAGDGPAE       420
     LKGLKGKEAL DKIAFKLPFA NVTPYVVIAF MLLVVVLMCF SASYRIAVIA GVIWLAVLFA       480
     AAQLALGKSG SERGEDAAVI VDAAAATAE                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page