(data stored in ACNUC30630 zone)

EMBL: AP009256.ASKB

AP009256.ASKB        Location/Qualifiers
FT   CDS             190752..191294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="askB"
FT                   /locus_tag="BAD_0140"
FT                   /product="aspartokinase"
FT                   /note="Aspartokinase beta subunit; AskB"
FT                   /note="COG family:aspartokinases"
FT                   /note="Orthologue of BL0493"
FT                   /note="PFAM_ID: ACT"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38921"
FT                   /db_xref="GOA:A0ZZN8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN8"
FT                   /protein_id="BAF38921.1"
FT                   /translation="MGDLFPDLGPEVPIISGVAHDSTESLATVRRVPNEPGMAAKVFTM
FT                   LAEAGVNVDMIVQASASTGTADISFTVPGTAAAKVQEVLQEKQGELGFQSFDVDPNVGK
FT                   VAVVGVGMKTHSGLAAKFFNALSDKGVNVLMISTSEIRIAALVPLEQLNDAVKALHTAY
FT                   GLDADQVEAVVYGGTGR"
     MGDLFPDLGP EVPIISGVAH DSTESLATVR RVPNEPGMAA KVFTMLAEAG VNVDMIVQAS        60
     ASTGTADISF TVPGTAAAKV QEVLQEKQGE LGFQSFDVDP NVGKVAVVGV GMKTHSGLAA       120
     KFFNALSDKG VNVLMISTSE IRIAALVPLE QLNDAVKALH TAYGLDADQV EAVVYGGTGR       180
//

If you have problems or comments...

PBIL Back to PBIL home page