(data stored in ACNUC30630 zone)

EMBL: AP009256.GLTL

AP009256.GLTL        Location/Qualifiers
FT   CDS             631341..632219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="BAD_0505"
FT                   /product="ATP binding protein of ABC transporter for
FT                   glutamate_aspartate"
FT                   /note="COG family: ABC-type polar amino acidtransport
FT                   system_ ATPase component"
FT                   /note="Orthologue of BL0076"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39286"
FT                   /db_xref="GOA:A1A0Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q3"
FT                   /protein_id="BAF39286.1"
FT                   /translation="MTEQAEQVTQTAQNSGKSQTSLEIRHLVKRYANADKPVLDDISFD
FT                   VPHGKVFVIVGPSGSGKSTLLRTIAGLEPIQGGTIALNGEIIETGKPGTESAGRSKRGS
FT                   ELRTRVGMVFQSYDLFPNKTVLGNITLAPTLVQKRDKAEVEKEAIALLERVGLADRKDA
FT                   WPHELSGGQRQRVAICRALILHPEVLLFDEVTAALDPEMVREVLDVMLELADSGQTMLI
FT                   VTHEMQFARAIADQVIMLEDGGIVEQSDDAEAFFTNPKTERAKRFLHTFEFDRHRRPAE
FT                   TPTEPTGTSAE"
     MTEQAEQVTQ TAQNSGKSQT SLEIRHLVKR YANADKPVLD DISFDVPHGK VFVIVGPSGS        60
     GKSTLLRTIA GLEPIQGGTI ALNGEIIETG KPGTESAGRS KRGSELRTRV GMVFQSYDLF       120
     PNKTVLGNIT LAPTLVQKRD KAEVEKEAIA LLERVGLADR KDAWPHELSG GQRQRVAICR       180
     ALILHPEVLL FDEVTAALDP EMVREVLDVM LELADSGQTM LIVTHEMQFA RAIADQVIML       240
     EDGGIVEQSD DAEAFFTNPK TERAKRFLHT FEFDRHRRPA ETPTEPTGTS AE               292
//

If you have problems or comments...

PBIL Back to PBIL home page