(data stored in ACNUC30630 zone)

EMBL: AP009256.GROES

AP009256.GROES       Location/Qualifiers
FT   CDS             387432..387725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BAD_0292"
FT                   /product="groES protein"
FT                   /note="COG family: co-chaperonin GroES (Hsp10)"
FT                   /note="Orthologue of BL1558"
FT                   /note="PFAM_ID: cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39073"
FT                   /db_xref="GOA:A1A040"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A040"
FT                   /protein_id="BAF39073.1"
FT                   /translation="MSISLTPLEDKIIVKQAEAETQTASGLFIPDNAKEKPQQGEVLAV
FT                   GPGRRNDAGERIPVDVKVGDKVLYSKYGGTEVHYQGEDYLIVSARDILAILG"
     MSISLTPLED KIIVKQAEAE TQTASGLFIP DNAKEKPQQG EVLAVGPGRR NDAGERIPVD        60
     VKVGDKVLYS KYGGTEVHYQ GEDYLIVSAR DILAILG                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page