(data stored in ACNUC30630 zone)

EMBL: AP009256.GUAB

AP009256.GUAB        Location/Qualifiers
FT   CDS             563078..564622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BAD_0450"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx19860_BL1722"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39231"
FT                   /db_xref="GOA:A1A0J8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J8"
FT                   /protein_id="BAF39231.1"
FT                   /translation="MATIPDMNADSTFAPLPPIFAQLGLAYDDVLLLPNETDVIPSEVD
FT                   TTTHLTRNITMKVPAISAAMDTVTESDMAIAMARNGGIGVLHRNLSIDDQAAQVDIVKR
FT                   SESGMINDPLTVSPDVTLADLDKLCGRFHISGLPVVDKDSKLVGIITNRDMRFIASEDY
FT                   DRLKVSEVMTRENLITGPSDISKEDAHDLLAKHKVEKLPLVDSEGHLTGLITVKDFVKT
FT                   EQYPDATKDEQGRLRVAAGIGFLGDAYNRASALMEAGVDVLVVDTANGEAKLALDMIRR
FT                   LKSDSAFNGVDIIGGNVATRQGAQAMIDAGVDAVKVGVGPGSICTTRVVAGVGVPQLTA
FT                   VYEAAQACRAAGVPCIADGGIHYSGDIAKALVAGASSVMLGGTLAGCEEAPGEKVLLHG
FT                   KQYKLYRGMGSLGAMAPRGKKSYSKDRYFQADVTSNDKVVPEGVEGEVPYRGPLNAVLY
FT                   QMIGGLHQSMFYIGAHNISEMPERGRFIRITDAGLRESHPHDIVMTAEAPNYSGRQ"
     MATIPDMNAD STFAPLPPIF AQLGLAYDDV LLLPNETDVI PSEVDTTTHL TRNITMKVPA        60
     ISAAMDTVTE SDMAIAMARN GGIGVLHRNL SIDDQAAQVD IVKRSESGMI NDPLTVSPDV       120
     TLADLDKLCG RFHISGLPVV DKDSKLVGII TNRDMRFIAS EDYDRLKVSE VMTRENLITG       180
     PSDISKEDAH DLLAKHKVEK LPLVDSEGHL TGLITVKDFV KTEQYPDATK DEQGRLRVAA       240
     GIGFLGDAYN RASALMEAGV DVLVVDTANG EAKLALDMIR RLKSDSAFNG VDIIGGNVAT       300
     RQGAQAMIDA GVDAVKVGVG PGSICTTRVV AGVGVPQLTA VYEAAQACRA AGVPCIADGG       360
     IHYSGDIAKA LVAGASSVML GGTLAGCEEA PGEKVLLHGK QYKLYRGMGS LGAMAPRGKK       420
     SYSKDRYFQA DVTSNDKVVP EGVEGEVPYR GPLNAVLYQM IGGLHQSMFY IGAHNISEMP       480
     ERGRFIRITD AGLRESHPHD IVMTAEAPNY SGRQ                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page