(data stored in ACNUC30630 zone)

EMBL: AP009256.HUP

AP009256.HUP         Location/Qualifiers
FT   CDS             complement(692781..693062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="BAD_0552"
FT                   /product="DNA-binding protein HB1"
FT                   /note="COG family: bacterial nucleoidDNA-binding protein"
FT                   /note="Orthologue of BL1798"
FT                   /note="PFAM_ID: Bac_DNA_binding"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39333"
FT                   /db_xref="GOA:A1A0V0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V0"
FT                   /protein_id="BAF39333.1"
FT                   /translation="MAYNKSDLVSKIAQKSNLTKAQAEAAVNAFQDVFVEAMQSGEGLK
FT                   LTGLFSAERVKRAARTGRNPRTGETIEIPATYGVRISAGSLLKKAVTK"
     MAYNKSDLVS KIAQKSNLTK AQAEAAVNAF QDVFVEAMQS GEGLKLTGLF SAERVKRAAR        60
     TGRNPRTGET IEIPATYGVR ISAGSLLKKA VTK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page