(data stored in ACNUC30630 zone)

EMBL: AP009256.ILVN

AP009256.ILVN        Location/Qualifiers
FT   CDS             complement(291973..292527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="BAD_0220"
FT                   /product="acetolactate synthase small subunit"
FT                   /note="Orthologue of BL0297"
FT                   /note="With IlvI Catalyzes the formation of
FT                   2-acetolactatefrom pyruvate_ the small subunit is required
FT                   for fullactivity and valine sensitivity"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39001"
FT                   /db_xref="GOA:A0ZZW8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW8"
FT                   /protein_id="BAF39001.1"
FT                   /translation="MANYPASQPGSKRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRVTVTADVEEVPLEQIIKQLNKLLHVLKIVDLDPETTVERELVLIKVAA
FT                   DESNRSDVLEIVRLFRVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGIIELVRSGAV
FT                   AVTRGPKALSEKVLGSEITGR"
     MANYPASQPG SKRHTLSVLV ENRPGVLARI AGLFARRAFN INSLSVSPTE RPDISRVTVT        60
     ADVEEVPLEQ IIKQLNKLLH VLKIVDLDPE TTVERELVLI KVAADESNRS DVLEIVRLFR       120
     VRVVDVNPES LTIEATGAEG KIDALLGLLE HYGIIELVRS GAVAVTRGPK ALSEKVLGSE       180
     ITGR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page