(data stored in ACNUC30630 zone)

EMBL: AP009256.LEUD

AP009256.LEUD        Location/Qualifiers
FT   CDS             245045..245734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BAD_0180"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="Catalyzes the isomerization between2-isopropylmalate
FT                   and 3-isopropylmalate in leucinebiosynthesis"
FT                   /note="Forms a heterodimer of LeuC_D"
FT                   /note="Orthologue of BL1263"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38961"
FT                   /db_xref="GOA:A0ZZS8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZS8"
FT                   /protein_id="BAF38961.1"
FT                   /translation="MEKLTTLTGVAVPLRRSNVDTDQIIPAVFLKRVKKSGFDDALFYA
FT                   WRRDPEFVLNKPEYKQGKILVAGPDFGIGSSREHAVWALHDYGFRVVISSRFADIFYGN
FT                   TAKNGVLAAIMPQESIELLWKLLDEEPGREMTVSLEDRTVTCGDVTLPFEVNDYTRWRL
FT                   MNGYDDIDLTLQHEDDIIAYEKMRAEKFPFKPKTLPVKREPEQPIESAREGEYPDWQGP
FT                   LADRGII"
     MEKLTTLTGV AVPLRRSNVD TDQIIPAVFL KRVKKSGFDD ALFYAWRRDP EFVLNKPEYK        60
     QGKILVAGPD FGIGSSREHA VWALHDYGFR VVISSRFADI FYGNTAKNGV LAAIMPQESI       120
     ELLWKLLDEE PGREMTVSLE DRTVTCGDVT LPFEVNDYTR WRLMNGYDDI DLTLQHEDDI       180
     IAYEKMRAEK FPFKPKTLPV KREPEQPIES AREGEYPDWQ GPLADRGII                   229
//

If you have problems or comments...

PBIL Back to PBIL home page