(data stored in ACNUC30630 zone)

EMBL: AP009256.NUSA

AP009256.NUSA        Location/Qualifiers
FT   CDS             443279..444331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BAD_0353"
FT                   /product="N utilization substance homolog"
FT                   /note="Binds to RNA polymerase and RNA; stimulates
FT                   rhoindependent termination by promoting hairpin
FT                   formation;also interacts with N protein and prevents
FT                   hairpinformation_ thereby preventing termination"
FT                   /note="Orthologue of BL1615"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39134"
FT                   /db_xref="GOA:A1A0A1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A1"
FT                   /protein_id="BAF39134.1"
FT                   /translation="MELDLAGMHQLAAGQGIDPETLDAALSEALRLAYLKTPHAAKHAR
FT                   VELDPRAGSFTVWAQDEIPGEPTEDDPHPAPTLGEEYDDTPHDFGRLAAATARQVISQL
FT                   FRKAEDDKVFGAFSGQKGKLITGIVQQDVKDTSNVHVAVGDVEALLPRREQVPGERYRH
FT                   GERIRVYVVNVARGLKGPEIVVSRSHPELVRRLFEREVPELVSGAVSIMAIAREAGART
FT                   KIAVRANTEGVNPKGALIGPGGARVRAVMENLGPEKIDIVDWSADPAKFVAAALSPAVA
FT                   TGVQVISEKNKTAIAFIHDDQLSLAIGKEGQNARLAAKLTGWKIGIESAEAHAKKMAES
FT                   ADHSDGETEE"
     MELDLAGMHQ LAAGQGIDPE TLDAALSEAL RLAYLKTPHA AKHARVELDP RAGSFTVWAQ        60
     DEIPGEPTED DPHPAPTLGE EYDDTPHDFG RLAAATARQV ISQLFRKAED DKVFGAFSGQ       120
     KGKLITGIVQ QDVKDTSNVH VAVGDVEALL PRREQVPGER YRHGERIRVY VVNVARGLKG       180
     PEIVVSRSHP ELVRRLFERE VPELVSGAVS IMAIAREAGA RTKIAVRANT EGVNPKGALI       240
     GPGGARVRAV MENLGPEKID IVDWSADPAK FVAAALSPAV ATGVQVISEK NKTAIAFIHD       300
     DQLSLAIGKE GQNARLAAKL TGWKIGIESA EAHAKKMAES ADHSDGETEE                  350
//

If you have problems or comments...

PBIL Back to PBIL home page