(data stored in ACNUC30630 zone)

EMBL: AP009256.OPPF

AP009256.OPPF        Location/Qualifiers
FT   CDS             604334..605089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BAD_0483"
FT                   /product="probable ATP binding protein of ABC transporter
FT                   for peptides"
FT                   /note="COG family: ATPase components of variousABC-type
FT                   transport systems_ contain duplicated ATPase"
FT                   /note="Orthologue of BL1157"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39264"
FT                   /db_xref="GOA:A1A0N1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N1"
FT                   /protein_id="BAF39264.1"
FT                   /translation="MVLRGRGLDKWYGAKHDRRQVLFGVDADVRAGECLAVIGGSGSGK
FT                   TTLTRVLLGLESADGGSVEYCGEPVRGDVAHSLRLQSGLVFQSPFDSLDPRWRIGRSIG
FT                   EPLRMHHPDWPRERVAERVTEVLEMVSLDPGTFVNRFPVDLSGGQAQRAAIARAIVDKP
FT                   KMLLADEPMSAIDVAARVRILDAFVAIRESQPDMAIIMVSHDLGVVQHIADRILVLHDG
FT                   RAVEVGPTDQVLGHPQDEYTKRLVQAASL"
     MVLRGRGLDK WYGAKHDRRQ VLFGVDADVR AGECLAVIGG SGSGKTTLTR VLLGLESADG        60
     GSVEYCGEPV RGDVAHSLRL QSGLVFQSPF DSLDPRWRIG RSIGEPLRMH HPDWPRERVA       120
     ERVTEVLEMV SLDPGTFVNR FPVDLSGGQA QRAAIARAIV DKPKMLLADE PMSAIDVAAR       180
     VRILDAFVAI RESQPDMAII MVSHDLGVVQ HIADRILVLH DGRAVEVGPT DQVLGHPQDE       240
     YTKRLVQAAS L                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page