(data stored in ACNUC30630 zone)

EMBL: AP009256.PE106

AP009256.PE106       Location/Qualifiers
FT   CDS             complement(146680..149508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0106"
FT                   /product="hypothetical membrane protein with similarity to
FT                   phage infection protein"
FT                   /note="COG family: predicted membrane protein"
FT                   /note="Orthologue of BL0446"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38887"
FT                   /db_xref="GOA:A0ZZK4"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK4"
FT                   /protein_id="BAF38887.1"
FT                   /translation="MHNVLQILRRDFKRLVTVPAAWVIMIGLILIPPLYAWFNIYGFWN
FT                   PYGNTDSIKVAVANMDEGTDNALLGKVNLGDQIEGTLKSNDQLGWEFMGKANAMEAVES
FT                   GDCYAAIVIPSDFSEDLANVVTNSKHRPTLEYYVNEKASPISPKITDQGATVVDRTVNN
FT                   TFVSTVSDVLVKAVNSANGTISGNTNAIANETIGELDNTKRNVGTIRSAIADFDTQLAN
FT                   VPQQTKAARNALNDVQLAAASAGRGLAGASTAIGTAQTQLNTLSSNANSALETGSGLVS
FT                   QATAQSTASINQISSAVSAASGSAQQAVTGMQNITDSNAKLLEKLKSASDNAQYQQIIS
FT                   KLENTNNTAAGTLADLKTLSENTQDTAGSVSKLSTDFNIGTQNSLKSAGTARNAINSGA
FT                   LPRLNSALGSLAGTAGTLAGTVTSQDSVVRQTNIVLDQLDQVASDARIGLEQTDQQLAK
FT                   METKLTTVSTDLKALGTTDLLASLTGSGSLDADKIASFMESPTVIDTKNVYPVNSYGSG
FT                   MAPLMTNLALWVGAFAFVVIYKVEVDDEGLEGLDPTATEKYLARYLLLGTMGVIQGAIC
FT                   TVGDLILGVQTACAPLFILTGMITSLVYLSITYALSTTFMHIGKGLCVALVIVQIPGAS
FT                   GLYPIEMMPKFFRMVYPFVPFSYSIDAFRETIAGFYDGHWIKAIGTLLLFAAMAFVIGL
FT                   VVRPLLVNLNRLFAREIKESDMIIGEEVELPERGYNMSQAIQVLADKGGYREVIEERAS
FT                   RFAELYPKLKRGALVIGFVVPVTLAAVFSFTNGEKVVVLATWVVWILLIMGFLMVIEYM
FT                   RDNLNRQVELGHLSDESIQSMLVERQAARIRRKKRAQQERRNRLLRKTRRRTSGKRTTS
FT                   DNRNTSVIKETTENVTGVNHNEDDGIAILVQKMQTTGPSAAANDAATDTTETTETAETT
FT                   ETTENTEERSNA"
     MHNVLQILRR DFKRLVTVPA AWVIMIGLIL IPPLYAWFNI YGFWNPYGNT DSIKVAVANM        60
     DEGTDNALLG KVNLGDQIEG TLKSNDQLGW EFMGKANAME AVESGDCYAA IVIPSDFSED       120
     LANVVTNSKH RPTLEYYVNE KASPISPKIT DQGATVVDRT VNNTFVSTVS DVLVKAVNSA       180
     NGTISGNTNA IANETIGELD NTKRNVGTIR SAIADFDTQL ANVPQQTKAA RNALNDVQLA       240
     AASAGRGLAG ASTAIGTAQT QLNTLSSNAN SALETGSGLV SQATAQSTAS INQISSAVSA       300
     ASGSAQQAVT GMQNITDSNA KLLEKLKSAS DNAQYQQIIS KLENTNNTAA GTLADLKTLS       360
     ENTQDTAGSV SKLSTDFNIG TQNSLKSAGT ARNAINSGAL PRLNSALGSL AGTAGTLAGT       420
     VTSQDSVVRQ TNIVLDQLDQ VASDARIGLE QTDQQLAKME TKLTTVSTDL KALGTTDLLA       480
     SLTGSGSLDA DKIASFMESP TVIDTKNVYP VNSYGSGMAP LMTNLALWVG AFAFVVIYKV       540
     EVDDEGLEGL DPTATEKYLA RYLLLGTMGV IQGAICTVGD LILGVQTACA PLFILTGMIT       600
     SLVYLSITYA LSTTFMHIGK GLCVALVIVQ IPGASGLYPI EMMPKFFRMV YPFVPFSYSI       660
     DAFRETIAGF YDGHWIKAIG TLLLFAAMAF VIGLVVRPLL VNLNRLFARE IKESDMIIGE       720
     EVELPERGYN MSQAIQVLAD KGGYREVIEE RASRFAELYP KLKRGALVIG FVVPVTLAAV       780
     FSFTNGEKVV VLATWVVWIL LIMGFLMVIE YMRDNLNRQV ELGHLSDESI QSMLVERQAA       840
     RIRRKKRAQQ ERRNRLLRKT RRRTSGKRTT SDNRNTSVIK ETTENVTGVN HNEDDGIAIL       900
     VQKMQTTGPS AAANDAATDT TETTETAETT ETTENTEERS NA                          942
//

If you have problems or comments...

PBIL Back to PBIL home page