(data stored in ACNUC30630 zone)

EMBL: AP009256.PE128

AP009256.PE128       Location/Qualifiers
FT   CDS             179939..180763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0128"
FT                   /product="hypothetical protein"
FT                   /note="COG family: septum formation
FT                   inhibitor-activatingATPase"
FT                   /note="Orthologue of BL0509"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38909"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM6"
FT                   /protein_id="BAF38909.1"
FT                   /translation="MGSPLESSSTRLKPVEAQPEPAPRNVVVVGSAVAGVGASTLAALL
FT                   ARELTERGCKSVLVDADLNGGGLDVLLGVEDEDGSRFGDISAPLGKVDGKALLRELPVW
FT                   DGVPLLACNPWRSENPQSWEIQACIRALAQVKDAVIVDAGQWRGLDDIPELAQATHITV
FT                   VEMTVLGLARAKVAMQSRGTAERQKHGHIVGVEPRGVARGRGVTTLEETENYLGHSLAA
FT                   VVKPDAKLCGELLDGLGLRRPNRQTVKALAALTDELQESLEGKRVKHGTRTP"
     MGSPLESSST RLKPVEAQPE PAPRNVVVVG SAVAGVGAST LAALLARELT ERGCKSVLVD        60
     ADLNGGGLDV LLGVEDEDGS RFGDISAPLG KVDGKALLRE LPVWDGVPLL ACNPWRSENP       120
     QSWEIQACIR ALAQVKDAVI VDAGQWRGLD DIPELAQATH ITVVEMTVLG LARAKVAMQS       180
     RGTAERQKHG HIVGVEPRGV ARGRGVTTLE ETENYLGHSL AAVVKPDAKL CGELLDGLGL       240
     RRPNRQTVKA LAALTDELQE SLEGKRVKHG TRTP                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page