(data stored in ACNUC30630 zone)

EMBL: AP009256.PE130

AP009256.PE130       Location/Qualifiers
FT   CDS             181736..182506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0130"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0507"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38911"
FT                   /db_xref="GOA:A0ZZM8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM8"
FT                   /protein_id="BAF38911.1"
FT                   /translation="MRDACGWEYCAAWLASMAVWLWLNRNVEWAGLRRLQRVLVRFGLR
FT                   SADDSGGADGDGTCDDESDGHGRTVRNDGENRDASPRMPTIGAAACVAALRASVRSGAT
FT                   LVQAFEELQGAPFAVPELTRFRIDMAVRSRCSLQEQHKHVDQLGAELHAACTLSLQLGC
FT                   EMSRCLEAVAASLKRRRLLDDLRANAFAMPQATVKLLMALPLLTVMLGECMGAHPLRFL
FT                   VEDVKGWMCLGFAGCCYAVGWYWIRRLMRQEHVR"
     MRDACGWEYC AAWLASMAVW LWLNRNVEWA GLRRLQRVLV RFGLRSADDS GGADGDGTCD        60
     DESDGHGRTV RNDGENRDAS PRMPTIGAAA CVAALRASVR SGATLVQAFE ELQGAPFAVP       120
     ELTRFRIDMA VRSRCSLQEQ HKHVDQLGAE LHAACTLSLQ LGCEMSRCLE AVAASLKRRR       180
     LLDDLRANAF AMPQATVKLL MALPLLTVML GECMGAHPLR FLVEDVKGWM CLGFAGCCYA       240
     VGWYWIRRLM RQEHVR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page