(data stored in ACNUC30630 zone)

EMBL: AP009256.PE132

AP009256.PE132       Location/Qualifiers
FT   CDS             183285..183572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0132"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0505"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38913"
FT                   /db_xref="GOA:A0ZZN0"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN0"
FT                   /protein_id="BAF38913.1"
FT                   /translation="MNDAMSINVDGSPGLMGRVGQKLCAAKERANKAVCLLDARMRLLT
FT                   AEPEKGAVTAEYAVVLVAATAFAAVLIAIVKSDVVKTLLTGLIKKALSVG"
     MNDAMSINVD GSPGLMGRVG QKLCAAKERA NKAVCLLDAR MRLLTAEPEK GAVTAEYAVV        60
     LVAATAFAAV LIAIVKSDVV KTLLTGLIKK ALSVG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page