(data stored in ACNUC30630 zone)

EMBL: AP009256.PE151

AP009256.PE151       Location/Qualifiers
FT   CDS             205760..206044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0151"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of BMAA0057"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38932"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP9"
FT                   /protein_id="BAF38932.1"
FT                   /translation="MSFRLPSGKFLPACVPIESALPPRCRRRAWALGRKLGRTALSVSS
FT                   THDRRRHRHWHEWRKRWTPMPSGSTASKHLPTMTRPSCYNDVRMIYSTL"
     MSFRLPSGKF LPACVPIESA LPPRCRRRAW ALGRKLGRTA LSVSSTHDRR RHRHWHEWRK        60
     RWTPMPSGST ASKHLPTMTR PSCYNDVRMI YSTL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page