(data stored in ACNUC30630 zone)

EMBL: AP009256.PE162

AP009256.PE162       Location/Qualifiers
FT   CDS             222170..222823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0162"
FT                   /product="thymidylate kinase"
FT                   /note="COG family: thymidylate kinase"
FT                   /note="Orthologue of BL0484"
FT                   /note="PFAM_ID: Thymidylate_kin"
FT                   /note="dTMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38943"
FT                   /db_xref="GOA:A0ZZR0"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZR0"
FT                   /protein_id="BAF38943.1"
FT                   /translation="MQGTFISFEGVDGVGKTTQVERLRAYVESQGRECVVTREPGGTAL
FT                   GVAIRKMLLHGVDTGDENDCADIAPRTEALLFAADRAQHVAEVILPALQRGAVVITDRY
FT                   LDSSLAYQAGGRELTAAEIRNLSMWATNGLLPERTYLLDMDPAQSHARLQHAEDRMEAA
FT                   GNDFQRRTRVAFLDLAEREPERFHVIDASQSIEDVWARIKADFDTVSTADGGIA"
     MQGTFISFEG VDGVGKTTQV ERLRAYVESQ GRECVVTREP GGTALGVAIR KMLLHGVDTG        60
     DENDCADIAP RTEALLFAAD RAQHVAEVIL PALQRGAVVI TDRYLDSSLA YQAGGRELTA       120
     AEIRNLSMWA TNGLLPERTY LLDMDPAQSH ARLQHAEDRM EAAGNDFQRR TRVAFLDLAE       180
     REPERFHVID ASQSIEDVWA RIKADFDTVS TADGGIA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page