(data stored in ACNUC30630 zone)

EMBL: AP009256.PE171

AP009256.PE171       Location/Qualifiers
FT   CDS             232732..233292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0171"
FT                   /product="narrowly conserved hypothetical membrane protein"
FT                   /note="COG family: uncharacterized membrane protein"
FT                   /note="Orthologue of BL0476"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38952"
FT                   /db_xref="GOA:A0ZZR9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR9"
FT                   /protein_id="BAF38952.1"
FT                   /translation="MRKLIEQLMKFGIVGVIAFIIDWGILNILVGAFHMHNVLAATISF
FT                   IISLIFNYVASMKMVFKHREDMARWMEIVIFVVGAVIGLFMNDAIIWISTYGMNHDAYV
FT                   SQSAEYLIRTNVGKLIATAVVMVWNFVTRKWLLDDTHTNATNRLKKKENRLSPEELEAK
FT                   WENSFSHKLGVWSLEHTPKGWPK"
     MRKLIEQLMK FGIVGVIAFI IDWGILNILV GAFHMHNVLA ATISFIISLI FNYVASMKMV        60
     FKHREDMARW MEIVIFVVGA VIGLFMNDAI IWISTYGMNH DAYVSQSAEY LIRTNVGKLI       120
     ATAVVMVWNF VTRKWLLDDT HTNATNRLKK KENRLSPEEL EAKWENSFSH KLGVWSLEHT       180
     PKGWPK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page