(data stored in ACNUC30630 zone)

EMBL: AP009256.PE173

AP009256.PE173       Location/Qualifiers
FT   CDS             235218..235877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0173"
FT                   /product="hypothetical protein"
FT                   /note="COG family: phosphoglyceratemutase_fructose-2_6-
FT                   bisphosphatase"
FT                   /note="Orthologue of BL0474"
FT                   /note="PFAM_ID: PGAM"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38954"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS1"
FT                   /protein_id="BAF38954.1"
FT                   /translation="MPATTIHFVRHGKVENPGHLLYERLPGFHLSDVGVRMAQATAHYI
FT                   AVSPQLNTVSAVYSSPLERTRETAGEILESLNSVRGLRGEEPLELQTDERLIEARNEFR
FT                   GKRIGFGEGALWKNGNWKLVRNLWKPSWGESYQSIAHRMQDFALEKVAEYPGKQIVVVS
FT                   HESPIWSYRHMLETGHPEHNMLLRHTALASITSITYDCNTGKIMSITYADPAADVE"
     MPATTIHFVR HGKVENPGHL LYERLPGFHL SDVGVRMAQA TAHYIAVSPQ LNTVSAVYSS        60
     PLERTRETAG EILESLNSVR GLRGEEPLEL QTDERLIEAR NEFRGKRIGF GEGALWKNGN       120
     WKLVRNLWKP SWGESYQSIA HRMQDFALEK VAEYPGKQIV VVSHESPIWS YRHMLETGHP       180
     EHNMLLRHTA LASITSITYD CNTGKIMSIT YADPAADVE                              219
//

If you have problems or comments...

PBIL Back to PBIL home page