(data stored in ACNUC30630 zone)

EMBL: AP009256.PE174

AP009256.PE174       Location/Qualifiers
FT   CDS             235961..237022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0174"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0473"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38955"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS2"
FT                   /protein_id="BAF38955.1"
FT                   /translation="MSFVYDQKVVDSMYGSHVVSMAVDYGVDLVKMWPLQTNQELENDV
FT                   KYAENLQVMFSGMMTQVLLKRSEEVDQSVAEAVYEGMDVLPGVDPEIIRTLMDANHAYD
FT                   VMASYHGVDGIELFMETARILGIDVETRIEKEIQDLMENLSRTMRSASGFEVDDDVAEN
FT                   VGICQSATVDRNEFARRYLASMTVLDALINLMCYGTDDSQEQAIRVLPVLLFVNAMRNQ
FT                   LSIPPTFINAEQLINLFGLRDTARQFGRPQSVFDSSFNPLTFSTTVKYLAFFAGQEWLR
FT                   HMRFLEWDPKQAEQDAKDEDERKSREALAKKYNLTSDGDNAASDADLDSSADSNLSEDS
FT                   DSSEEAGSEPTEE"
     MSFVYDQKVV DSMYGSHVVS MAVDYGVDLV KMWPLQTNQE LENDVKYAEN LQVMFSGMMT        60
     QVLLKRSEEV DQSVAEAVYE GMDVLPGVDP EIIRTLMDAN HAYDVMASYH GVDGIELFME       120
     TARILGIDVE TRIEKEIQDL MENLSRTMRS ASGFEVDDDV AENVGICQSA TVDRNEFARR       180
     YLASMTVLDA LINLMCYGTD DSQEQAIRVL PVLLFVNAMR NQLSIPPTFI NAEQLINLFG       240
     LRDTARQFGR PQSVFDSSFN PLTFSTTVKY LAFFAGQEWL RHMRFLEWDP KQAEQDAKDE       300
     DERKSREALA KKYNLTSDGD NAASDADLDS SADSNLSEDS DSSEEAGSEP TEE              353
//

If you have problems or comments...

PBIL Back to PBIL home page