(data stored in ACNUC30630 zone)

EMBL: AP009256.PE18

AP009256.PE18        Location/Qualifiers
FT   CDS             complement(21535..21954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0018"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of DET1106"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38799"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB6"
FT                   /protein_id="BAF38799.1"
FT                   /translation="MNNSLFNTTQETATRLTLCLPLLSRPSTIDEITAIDLIATYMKTF
FT                   GFGQRNLHGDGPHALAEYDARRKRIQAGLAQLVIVGAATVDSTCLLYRATPECFQYSEA
FT                   LHGDYAASYRQAVQLLIKNDYETIMNRITKENNQL"
     MNNSLFNTTQ ETATRLTLCL PLLSRPSTID EITAIDLIAT YMKTFGFGQR NLHGDGPHAL        60
     AEYDARRKRI QAGLAQLVIV GAATVDSTCL LYRATPECFQ YSEALHGDYA ASYRQAVQLL       120
     IKNDYETIMN RITKENNQL                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page