(data stored in ACNUC30630 zone)

EMBL: AP009256.PE184

AP009256.PE184       Location/Qualifiers
FT   CDS             250836..251756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0184"
FT                   /product="hypothetical protein"
FT                   /note="COG family: 1-acyl-sn-glycerol-3-
FT                   phosphateacyltransferase"
FT                   /note="Orthologue of BL0347"
FT                   /note="PFAM_ID: Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38965"
FT                   /db_xref="GOA:A0ZZT2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT2"
FT                   /protein_id="BAF38965.1"
FT                   /translation="MTNVSAAGGTMEAMASKGKPSPRSAVKPLSDEQVAKLAQKHHLVD
FT                   PTHDFPTGPRKANTTEIEAQNPKATHRLLTGCDVVLRNHSKVKAWGLEHVPETGPFITA
FT                   ATHVTMYDVFVPMVSMFHQGRRPRYMAKAEMAKWPLIGKWFQLVGMQPVQRRAGKAKAI
FT                   EETSVEILTSGRPLTVWPEGTVTRDPQKWPMSMKNGVGVIALESSRRLGYQVPLYCAVT
FT                   WGAASINHWWPWPRKNVVMCYDEALDYADLLDGCDSWGDEVPTDRADELTRRIRVRMTE
FT                   IMAEIRGEQAPDGYWDYRTMSRVKD"
     MTNVSAAGGT MEAMASKGKP SPRSAVKPLS DEQVAKLAQK HHLVDPTHDF PTGPRKANTT        60
     EIEAQNPKAT HRLLTGCDVV LRNHSKVKAW GLEHVPETGP FITAATHVTM YDVFVPMVSM       120
     FHQGRRPRYM AKAEMAKWPL IGKWFQLVGM QPVQRRAGKA KAIEETSVEI LTSGRPLTVW       180
     PEGTVTRDPQ KWPMSMKNGV GVIALESSRR LGYQVPLYCA VTWGAASINH WWPWPRKNVV       240
     MCYDEALDYA DLLDGCDSWG DEVPTDRADE LTRRIRVRMT EIMAEIRGEQ APDGYWDYRT       300
     MSRVKD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page