(data stored in ACNUC30630 zone)

EMBL: AP009256.PE19

AP009256.PE19        Location/Qualifiers
FT   CDS             complement(22263..23174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0019"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0608"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38800"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB7"
FT                   /protein_id="BAF38800.1"
FT                   /translation="MCLVSNPFNRRKLRFSDPAVSGVYWRYSSVLPAYSSESGFHRRNS
FT                   DLMGRRRMKTNGDEKETHLAETTATYALGVFCQLVNPYISGVDHHKKGFMKDFFDAVLE
FT                   DDGLRNPLPQHHRNRKPGKTTITTGVWSGINDTDLTRFYNGRKKIPAWKAAEFYQRLDI
FT                   SKVERLCCDISIDALADFQKELIKANIRVTDISELPSATGKWLLSILQANAGGRDILID
FT                   GISFQPKFDIFENLPLASGRINNGKLHLGRSSVPWKAYPIPPDKPDDHLEKDIPHADAS
FT                   RLCRSLAQANQLFRRSSSDMSS"
     MCLVSNPFNR RKLRFSDPAV SGVYWRYSSV LPAYSSESGF HRRNSDLMGR RRMKTNGDEK        60
     ETHLAETTAT YALGVFCQLV NPYISGVDHH KKGFMKDFFD AVLEDDGLRN PLPQHHRNRK       120
     PGKTTITTGV WSGINDTDLT RFYNGRKKIP AWKAAEFYQR LDISKVERLC CDISIDALAD       180
     FQKELIKANI RVTDISELPS ATGKWLLSIL QANAGGRDIL IDGISFQPKF DIFENLPLAS       240
     GRINNGKLHL GRSSVPWKAY PIPPDKPDDH LEKDIPHADA SRLCRSLAQA NQLFRRSSSD       300
     MSS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page