(data stored in ACNUC30630 zone)

EMBL: AP009256.PE195

AP009256.PE195       Location/Qualifiers
FT   CDS             263786..264463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0195"
FT                   /product="hypothetical protein"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL0337"
FT                   /note="PFAM_ID:tetR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38976"
FT                   /db_xref="GOA:A0ZZU3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU3"
FT                   /protein_id="BAF38976.1"
FT                   /translation="MPRPRRDSEILPAKERLENAFWELLSEREYRKITVTDIVRTADVN
FT                   RNSFYYHFTGLPELADSAILHAVENTPLPSAPNANFNPDNEWRKHVTALLREPEQRQRL
FT                   DRLALLAGPHSSPELVESLQDFGRLTLISVLGLDADHLDLKTDLMLDFTVGGMLAVLRR
FT                   WPKLHEQLPMDAVFNEDVAVLATGIFMSMSKTDMLGYWKRIFSSGFVAGQGVQSEAEQK
FT                   AEQ"
     MPRPRRDSEI LPAKERLENA FWELLSEREY RKITVTDIVR TADVNRNSFY YHFTGLPELA        60
     DSAILHAVEN TPLPSAPNAN FNPDNEWRKH VTALLREPEQ RQRLDRLALL AGPHSSPELV       120
     ESLQDFGRLT LISVLGLDAD HLDLKTDLML DFTVGGMLAV LRRWPKLHEQ LPMDAVFNED       180
     VAVLATGIFM SMSKTDMLGY WKRIFSSGFV AGQGVQSEAE QKAEQ                       225
//

If you have problems or comments...

PBIL Back to PBIL home page