(data stored in ACNUC30630 zone)

EMBL: AP009256.PE205

AP009256.PE205       Location/Qualifiers
FT   CDS             275844..276473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0205"
FT                   /product="hypothetical protein"
FT                   /note="COG family: N6-adenine-specific methylase"
FT                   /note="Orthologue of BL0328"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38986"
FT                   /db_xref="GOA:A0ZZV3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV3"
FT                   /protein_id="BAF38986.1"
FT                   /translation="MVMRVISGRFKGMALTTPKPGTRPTTDRTKEAIFSHLDSWGVLDD
FT                   ARVLDLFAGTGALGIEALSRGARELVAVESAAPAAALIAKTLTALKHNRSWEPGMSARV
FT                   VKARAEKYAAAASAIAPFGVIFIDPPYAFETEACNRLLADLAGRESGELTGEGTVIVLE
FT                   RSTRSDEPTAPEGWDITDRRDYGETAVYYIEPAETAEPAEPVESAD"
     MVMRVISGRF KGMALTTPKP GTRPTTDRTK EAIFSHLDSW GVLDDARVLD LFAGTGALGI        60
     EALSRGAREL VAVESAAPAA ALIAKTLTAL KHNRSWEPGM SARVVKARAE KYAAAASAIA       120
     PFGVIFIDPP YAFETEACNR LLADLAGRES GELTGEGTVI VLERSTRSDE PTAPEGWDIT       180
     DRRDYGETAV YYIEPAETAE PAEPVESAD                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page