(data stored in ACNUC30630 zone)

EMBL: AP009256.PE21

AP009256.PE21        Location/Qualifiers
FT   CDS             complement(26853..27488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0021"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0607"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38802"
FT                   /db_xref="GOA:A0ZZB9"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB9"
FT                   /protein_id="BAF38802.1"
FT                   /translation="MNGEVPCRLTARASPFASHGPRLAGDGAHGTGARAERQTRMIGGG
FT                   HMDAERDTDGTTDAHEGDHTPADGAGTEGEGGKPDTRPGDRLATIRRTLWWIGLALQLP
FT                   FALTLIHFDTPYLILERILCAIPPRLASDPSSIVGIPALETEWCREFLALVLGAVCWVT
FT                   AGVMRLVADSPSNHGKETLPVRIFAGIITIIVLMATGITGLFLGIAAF"
     MNGEVPCRLT ARASPFASHG PRLAGDGAHG TGARAERQTR MIGGGHMDAE RDTDGTTDAH        60
     EGDHTPADGA GTEGEGGKPD TRPGDRLATI RRTLWWIGLA LQLPFALTLI HFDTPYLILE       120
     RILCAIPPRL ASDPSSIVGI PALETEWCRE FLALVLGAVC WVTAGVMRLV ADSPSNHGKE       180
     TLPVRIFAGI ITIIVLMATG ITGLFLGIAA F                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page