(data stored in ACNUC30630 zone)

EMBL: AP009256.PE215

AP009256.PE215       Location/Qualifiers
FT   CDS             287356..287994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0215"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of STH1505"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38996"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW3"
FT                   /protein_id="BAF38996.1"
FT                   /translation="MRQQGVALEISVSYSCSYGGGAVLRKNNQWGCLMNQVMRRSVCCL
FT                   LSALLLCSCAGCANSVHETSDGDAARSSSKNDDAAEQAYKAFTVDALDRVAADDLNNSD
FT                   KLVLVNKLGAKSVHGDGAIPFAKKVDENHMYYVVSMCKQKEQAPYSLVLYKDGQPHTLT
FT                   TRESCTSNGVETVSLPAKNFLGATSLSIINIGNTDLVVSVYEVKESHRE"
     MRQQGVALEI SVSYSCSYGG GAVLRKNNQW GCLMNQVMRR SVCCLLSALL LCSCAGCANS        60
     VHETSDGDAA RSSSKNDDAA EQAYKAFTVD ALDRVAADDL NNSDKLVLVN KLGAKSVHGD       120
     GAIPFAKKVD ENHMYYVVSM CKQKEQAPYS LVLYKDGQPH TLTTRESCTS NGVETVSLPA       180
     KNFLGATSLS IINIGNTDLV VSVYEVKESH RE                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page