(data stored in ACNUC30630 zone)

EMBL: AP009256.PE226

AP009256.PE226       Location/Qualifiers
FT   CDS             complement(296824..297654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0226"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0292"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39007"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX4"
FT                   /protein_id="BAF39007.1"
FT                   /translation="MMSEETNDFKPLADADDATSQQPVTPAADYPATGAVAGTAATNNS
FT                   ATGNAADRATDEPAKPAKSSKPSISMSDLPDLRATFDPDAPLDDSSDRSRDEFTTVYDI
FT                   IDSIEEELDEAKPILFAPSSVRVDRESFTGKLDKLKKMLPVQLERASALMRESERRLES
FT                   AQTQANVIIASAQSRAADTVREANEQAQFLAGQENVTELARQKARGILDQAQAKADKLT
FT                   QNADKYCITMMESLQQQVDKIGTGVQAGLNVLYDRQREAGAHLDHLDADDYPEN"
     MMSEETNDFK PLADADDATS QQPVTPAADY PATGAVAGTA ATNNSATGNA ADRATDEPAK        60
     PAKSSKPSIS MSDLPDLRAT FDPDAPLDDS SDRSRDEFTT VYDIIDSIEE ELDEAKPILF       120
     APSSVRVDRE SFTGKLDKLK KMLPVQLERA SALMRESERR LESAQTQANV IIASAQSRAA       180
     DTVREANEQA QFLAGQENVT ELARQKARGI LDQAQAKADK LTQNADKYCI TMMESLQQQV       240
     DKIGTGVQAG LNVLYDRQRE AGAHLDHLDA DDYPEN                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page