(data stored in ACNUC30630 zone)

EMBL: AP009256.PE227

AP009256.PE227       Location/Qualifiers
FT   CDS             298301..298618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0227"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of Tfu_2388"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39008"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX5"
FT                   /protein_id="BAF39008.1"
FT                   /translation="MVFAIFDGLFGSDDPVSPLSNPDAGTGTAVLERPEEETKLDDGGN
FT                   GDADRFAHYVSRDRIAESKMTGRPVVALCGKVWVPKRDPTHYPVCPDCKRIYDEMMNSS
FT                   F"
     MVFAIFDGLF GSDDPVSPLS NPDAGTGTAV LERPEEETKL DDGGNGDADR FAHYVSRDRI        60
     AESKMTGRPV VALCGKVWVP KRDPTHYPVC PDCKRIYDEM MNSSF                       105
//

If you have problems or comments...

PBIL Back to PBIL home page