(data stored in ACNUC30630 zone)

EMBL: AP009256.PE23

AP009256.PE23        Location/Qualifiers
FT   CDS             complement(28422..29057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0023"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0605"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38804"
FT                   /db_xref="GOA:A0ZZC1"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC1"
FT                   /protein_id="BAF38804.1"
FT                   /translation="MIGGDMDKPSNERGSTGPTDGIKAEGDAGNERHICKANPAMIDDI
FT                   GKKHGLEDTSENFSGKKYALAPKAATKFLKASRCYVALGKARRVLWWLGLLLLSPALIL
FT                   WAEWGANGDDDTIICRVLTFSSSSCMNLTTATEYVRRLTLVLIMGVVCWIAALVIFGVR
FT                   SYMRSVYPELRDHSSSASHVLVGIISFLVLVMVFPVLVITLLSALMTL"
     MIGGDMDKPS NERGSTGPTD GIKAEGDAGN ERHICKANPA MIDDIGKKHG LEDTSENFSG        60
     KKYALAPKAA TKFLKASRCY VALGKARRVL WWLGLLLLSP ALILWAEWGA NGDDDTIICR       120
     VLTFSSSSCM NLTTATEYVR RLTLVLIMGV VCWIAALVIF GVRSYMRSVY PELRDHSSSA       180
     SHVLVGIISF LVLVMVFPVL VITLLSALMT L                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page