(data stored in ACNUC30630 zone)

EMBL: AP009256.PE232

AP009256.PE232       Location/Qualifiers
FT   CDS             305697..306098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0232"
FT                   /product="putative 50S ribosomal protein L19"
FT                   /note="Orthologue of CE1932"
FT                   /note="This protein is located at the 30S-50S
FT                   ribosomalsubunit interface and may play a role in the
FT                   structure andfunction of the aminoacyl-tRNA binding site"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39013"
FT                   /db_xref="GOA:A0ZZY0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZY0"
FT                   /protein_id="BAF39013.1"
FT                   /translation="MRRYAAATRGNTMVNAIEAFDAKHMKPAEEIPAFRPGDTVEVNVK
FT                   IKEGNNSRIQAFTGVVIARQGGGVRETFVVRKISFGTGVERRFPLHSPAIDSIKVVRKG
FT                   RVRRAKLYYLRNLRGKAARIVERRDNSEK"
     MRRYAAATRG NTMVNAIEAF DAKHMKPAEE IPAFRPGDTV EVNVKIKEGN NSRIQAFTGV        60
     VIARQGGGVR ETFVVRKISF GTGVERRFPL HSPAIDSIKV VRKGRVRRAK LYYLRNLRGK       120
     AARIVERRDN SEK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page