(data stored in ACNUC30630 zone)

EMBL: AP009256.PE233

AP009256.PE233       Location/Qualifiers
FT   CDS             306165..306539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0233"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of BURPS1710b_3413"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39014"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY1"
FT                   /protein_id="BAF39014.1"
FT                   /translation="MGRYDRGQCVKPDGKESHEACQKKSRKRGKLRLTRHPDLVRHTHR
FT                   HRAAGAHVPVRLLRDSVRLHAEHHRTGRPGHHQQTHPQSLQAPARRRGGLQGPRPLAAA
FT                   GEQRPIRRRLPHQTTYRPAR"
     MGRYDRGQCV KPDGKESHEA CQKKSRKRGK LRLTRHPDLV RHTHRHRAAG AHVPVRLLRD        60
     SVRLHAEHHR TGRPGHHQQT HPQSLQAPAR RRGGLQGPRP LAAAGEQRPI RRRLPHQTTY       120
     RPAR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page