(data stored in ACNUC30630 zone)

EMBL: AP009256.PE237

AP009256.PE237       Location/Qualifiers
FT   CDS             complement(309984..310928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0237"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted permeases"
FT                   /note="Orthologue of BL1279"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39018"
FT                   /db_xref="GOA:A0ZZY5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY5"
FT                   /protein_id="BAF39018.1"
FT                   /translation="MPGLLSAMEGFCVIGIVIATGYVAARMRIGGPTAQMVLNRFSFFV
FT                   SSPCLMFAILSKEKIFEIFHSSIVVAFFSALLVGVVFLILNRLFFHMKAADATIGALNS
FT                   LYLNSNNIGLPIATYILGNPALVAPILVMQQAVFTPIGLTVLDVTTKGKVSAKEILKQP
FT                   LHQPLLIGSLLGIVVSAISAKVGYFVVPDCIYDPIDMIGNSAVPMILMAFGMSLHGTKP
FT                   LQDKSNIPAVFTVAALKNIVMPIIAFLLSYFVMGFRGATLYACVVLAALPTGQNVYNYA
FT                   ARYNVGLSFARDGILFSTLSSPIFIAIIAVLLG"
     MPGLLSAMEG FCVIGIVIAT GYVAARMRIG GPTAQMVLNR FSFFVSSPCL MFAILSKEKI        60
     FEIFHSSIVV AFFSALLVGV VFLILNRLFF HMKAADATIG ALNSLYLNSN NIGLPIATYI       120
     LGNPALVAPI LVMQQAVFTP IGLTVLDVTT KGKVSAKEIL KQPLHQPLLI GSLLGIVVSA       180
     ISAKVGYFVV PDCIYDPIDM IGNSAVPMIL MAFGMSLHGT KPLQDKSNIP AVFTVAALKN       240
     IVMPIIAFLL SYFVMGFRGA TLYACVVLAA LPTGQNVYNY AARYNVGLSF ARDGILFSTL       300
     SSPIFIAIIA VLLG                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page